PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P19010_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 801aa    MW: 88171.2 Da    PI: 6.1313
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P19010_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.7e-20106161156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            r++ +++t+ q++e+e+lF+++++p++++r +L+++l+L+ rqVk+WFqNrR+++k
  GSMUA_Achr4P19010_001 106 RKRYHRHTTRQIQEMEALFKECPHPDEKQRMKLSQELSLKPRQVKFWFQNRRTQMK 161
                            788999***********************************************998 PP

2START105.49.5e-342805313206
                            HHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
                  START   3 aeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla 77 
                            a +aa+ lv++   + p+W +       +evl  +e +k+              ++ea+r+s++v+m++ +lv  +ld   +W   ++
  GSMUA_Achr4P19010_001 280 AITAADHLVRMCRTNGPLWIRRD--GRTTEVLDLEEHAKNfswpmdlkqqhgeIRTEASRDSAMVIMNSITLVDAFLDAD-KWMGLFP 364
                            56677777788888888887777..3333333333333333445556666677899************************.8888888 PP

                            ....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEE CS
                  START  78 ....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.sssvvRaellpSgi 152
                                ka+t++v+s+g      g l+l  aelq+lsplvp R+  f Ry +  +++g+w+ivd  vd + +  + s +  R  +++Sg+
  GSMUA_Achr4P19010_001 365 svvsKATTVQVLSPGvaghgnGCLHLLHAELQFLSPLVPaREAHFFRYLQHnSEEGTWIIVDFPVDGCVDGLQtSLPWYR--RRTSGC 450
                            8888******************************************************************9855555555..9***** PP

                            EEEEECTCE...........................EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 153 liepksngh...........................skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            +i++++ng+                             v wveh++++++ +h+++ ++v++g+a+ga +wv+tlqrqce+
  GSMUA_Achr4P19010_001 451 VIQDMPNGYskvqnelrflsaklmfsikssvlipfiNDVMWVEHAEVEDKPVHQIFDQFVSTGVAFGATRWVSTLQRQCER 531
                            *******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-2083165IPR009057Homeodomain-like
SuperFamilySSF466897.27E-1994164IPR009057Homeodomain-like
PROSITE profilePS5007117.054103163IPR001356Homeobox domain
SMARTSM003892.0E-17104167IPR001356Homeobox domain
CDDcd000861.98E-18105164No hitNo description
PfamPF000463.5E-17106161IPR001356Homeobox domain
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PROSITE profilePS5084835.703269534IPR002913START domain
SuperFamilySSF559611.0E-18272458No hitNo description
CDDcd088752.09E-96273530No hitNo description
SMARTSM002349.9E-14278531IPR002913START domain
PfamPF018529.3E-27281531IPR002913START domain
SuperFamilySSF559611.0E-18486533No hitNo description
SuperFamilySSF559611.06E-19548782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 801 aa     Download sequence    Send to blast
MYGDCQVLSS MVSGNVASPD SLFASPIQNP NLGFMANMPP FNAFSSIIPK EEGLMLIGRG  60
VSKEEEMESG SGSGPLDGVL SCGEEHDNEL QQQPPSQQQQ QPVAKRKRYH RHTTRQIQEM  120
EALFKECPHP DEKQRMKLSQ ELSLKPRQVK FWFQNRRTQM KAQQDRADNV VLRAENESLK  180
NENFRLQAAI QNVVCPNCGG PAILGEMSFD EQQLRIENAR LKDELERLSC IASRYSGRQQ  240
QPLVVSCNDI IPVPQISDQA SPFSGMLILD QEKPLVLDLA ITAADHLVRM CRTNGPLWIR  300
RDGRTTEVLD LEEHAKNFSW PMDLKQQHGE IRTEASRDSA MVIMNSITLV DAFLDADKWM  360
GLFPSVVSKA TTVQVLSPGV AGHGNGCLHL LHAELQFLSP LVPAREAHFF RYLQHNSEEG  420
TWIIVDFPVD GCVDGLQTSL PWYRRRTSGC VIQDMPNGYS KVQNELRFLS AKLMFSIKSS  480
VLIPFINDVM WVEHAEVEDK PVHQIFDQFV STGVAFGATR WVSTLQRQCE RLASLLARNI  540
ADLGVIPTPE ARKNMMKLSQ RMMRTFCASV HASGMQSWTA LSESSDDTIR VTTRKNTEPG  600
QPNGVILTAV STTWLPFSHQ QVFELLTDEQ RRSQLDVLSS GNSLHEVAHI ANGSHPRNCV  660
SLLRVNAASN SSHSVELLLQ ESSTHPSGGS IVVYATIDVD AVQVAMSGED PSYIPLLPTG  720
FVISPAAPPN GVISSSDGSA STIGCLLTIG MQVLASAVPS AKLNLSSVTA INNHLRNTVQ  780
QISAVLGGGA VAEPAAMAPE Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397149.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLM0SQ640.0M0SQ64_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P19010_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7